Skip to content

Modelangelo v1.0.1 failing if the fasta contains unknown residues "X" #53

Description

@sroet

Hey,

I have a fasta file where certain residues are unknown and therefor represented with X
such as (1 at the start and 1 at place 105):

>chain 'CM'
XPFKRFVEIGRVALVNYGKDYGRLVVIVDVVDQNRALVDAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDXDRFKVMLAKIKRGGAIRQELAKLKKTAAA

When trying to build against these fasta sequences you get an internal assertion error:

click here for the log file
2023-06-15 at 17:54:09 | INFO | ModelAngelo with args: {'volume_path': '../sharpened.mrc', 'protein_fasta': '../fasta_files/proteins.fa', 'rna_fasta': '../fasta_files/rna.fa', 'dna_fasta': None, 'output_dir': '20230615_fasta', 'mask_path': None, 'device': '0', 'config_path': None, 'model_bundle_name': 'nucleotides', 'model_bundle_path': None, 'keep_intermediate_results': False, 'pipeline_control': False, 'func': <function main at 0x7f302c6b9430>}
2023-06-15 at 17:54:09 | INFO | Initial C-alpha prediction with args: {'model_checkpoint': 'chkpt.torch', 'bfactor': 0, 'batch_size': 4, 'box_size': 64, 'stride': 16, 'dont_mask_input': True, 'threshold': 0.05, 'save_real_coordinates': False, 'save_cryo_em_grid': False, 'do_nucleotides': True, 'save_backbone_trace': False, 'save_output_grid': False, 'crop': 6, 'log_dir': '/data/public/model_angelo_weights/hub/checkpoints/model_angelo_v1.0/nucleotides/c_alpha', 'map_path': '../sharpened.mrc', 'output_path': '20230615_fasta/see_alpha_output', 'mask_path': None, 'device': '0', 'auto_mask': False}
2023-06-15 at 17:54:09 | INFO | Using model file /data/public/model_angelo_weights/hub/checkpoints/model_angelo_v1.0/nucleotides/c_alpha/model.py
2023-06-15 at 17:54:09 | INFO | Using checkpoint file /data/public/model_angelo_weights/hub/checkpoints/model_angelo_v1.0/nucleotides/c_alpha/chkpt.torch
2023-06-15 at 17:54:10 | INFO | Input structure has shape: (162, 162, 162)
2023-06-15 at 17:54:10 | INFO | Running with these arguments:
2023-06-15 at 17:54:10 | INFO | {'model_checkpoint': 'chkpt.torch', 'bfactor': 0, 'batch_size': 4, 'box_size': 64, 'stride': 16, 'dont_mask_input': True, 'threshold': 0.05, 'save_real_coordinates': False, 'save_cryo_em_grid': False, 'do_nucleotides': True, 'save_backbone_trace': False, 'save_output_grid': False, 'crop': 6, 'log_dir': '/data/public/model_angelo_weights/hub/checkpoints/model_angelo_v1.0/nucleotides/c_alpha', 'map_path': '../sharpened.mrc', 'output_path': '20230615_fasta/see_alpha_output', 'mask_path': None, 'device': '0', 'auto_mask': False}
2023-06-15 at 18:01:55 | INFO | Model prediction done, took 465.11 seconds for 343 sliding windows
2023-06-15 at 18:01:55 | INFO | Average time is 1356.012 ms
2023-06-15 at 18:01:55 | INFO | Starting Cα grid to points...
2023-06-15 at 18:01:56 | INFO | Have 17015 Cα points before pruning and 7629 after pruning
2023-06-15 at 18:01:57 | INFO | Starting P grid to points...
2023-06-15 at 18:01:58 | INFO | Have 10785 P points before pruning and 4260 after pruning
2023-06-15 at 18:01:59 | INFO | Finished inference!
2023-06-15 at 18:01:59 | INFO | GNN model refinement round 1 with args: {'num_rounds': 3, 'crop_length': 200, 'repeat_per_residue': 1, 'esm_model': 'esm1b_t33_650M_UR50S', 'aggressive_pruning': True, 'seq_attention_batch_size': 200, 'fp16': False, 'batch_size': 1, 'voxel_size': 1.0, 'map': '../sharpened.mrc', 'protein_fasta': '../fasta_files/proteins.fa', 'rna_fasta': '../fasta_files/rna.fa', 'dna_fasta': None, 'struct': '20230615_fasta/see_alpha_output/see_alpha_merged_output.cif', 'output_dir': '20230615_fasta/gnn_output_round_1', 'model_dir': '/data/public/model_angelo_weights/hub/checkpoints/model_angelo_v1.0/nucleotides/gnn', 'device': '0', 'write_hmm_profiles': False, 'refine': False}
2023-06-15 at 18:01:59 | INFO | Loaded module from step: 483863
2023-06-15 at 18:02:49 | ERROR | Error in ModelAngelo
Traceback (most recent call last):

  File "/opt/apps/miniconda3/envs/model_angelo/bin/model_angelo", line 33, in <module>
    sys.exit(load_entry_point('model-angelo==1.0.1', 'console_scripts', 'model_angelo')())
    │   │    └ <function importlib_load_entry_point at 0x7f30f12630d0>
    │   └ <built-in function exit>
    └ <module 'sys' (built-in)>
  File "/opt/apps/miniconda3/envs/model_angelo/lib/python3.9/site-packages/model_angelo-1.0.1-py3.9.egg/model_angelo/__main__.py", line 52, in main
    args.func(args)
    │    │    └ Namespace(volume_path='../sharpened.mrc', protein_fasta='../fasta_files/proteins.fa', rna_fasta='../fasta_files/rna.fa', dna_...
    │    └ <function main at 0x7f302c6b9430>
    └ Namespace(volume_path='../sharpened.mrc', protein_fasta='../fasta_files/proteins.fa', rna_fasta='../fasta_files/rna.fa', dna_...
> File "/opt/apps/miniconda3/envs/model_angelo/lib/python3.9/site-packages/model_angelo-1.0.1-py3.9.egg/model_angelo/apps/build.py", line 241, in main
    gnn_output = gnn_infer(gnn_infer_args)
                 │         └ {'num_rounds': 3, 'crop_length': 200, 'repeat_per_residue': 1, 'esm_model': 'esm1b_t33_650M_UR50S', 'aggressive_pruning': Tru...
                 └ <function infer at 0x7f302d433d30>
  File "/opt/apps/miniconda3/envs/model_angelo/lib/python3.9/site-packages/model_angelo-1.0.1-py3.9.egg/model_angelo/gnn/inference.py", line 92, in infer
    protein = get_lm_embeddings_for_protein(lang_model, batch_converter, protein)
              │                             │           │                └ Protein(atom_positions=None, atomc_positions=None, aatype=None, atom_mask=None, atomc_mask=None, residue_index=None, chain_in...
              │                             │           └ <esm.data.BatchConverter object at 0x7f301e126fd0>
              │                             └ ProteinBertModel(
              │                                 (embed_tokens): Embedding(33, 1280, padding_idx=1)
              │                                 (layers): ModuleList(
              │                                   (0): TransformerLayer(
              │                                  ...
              └ <function get_lm_embeddings_for_protein at 0x7f302d433e50>
  File "/opt/apps/miniconda3/envs/model_angelo/lib/python3.9/site-packages/model_angelo-1.0.1-py3.9.egg/model_angelo/data/generate_complete_prot_files.py", line 34, in get_lm_embeddings_for_protein
    protein_with_lm = add_lm_embeddings_to_protein(protein, lm_embeddings)
                      │                            │        └ array([[ 8.0417655e-04,  3.0484083e-01,  6.0511094e-01, ...,
                      │                            │                  -2.1142796e-01, -2.8297421e-01, -9.1318183e-02],
                      │                            │                 ...
                      │                            └ Protein(atom_positions=None, atomc_positions=None, aatype=None, atom_mask=None, atomc_mask=None, residue_index=None, chain_in...
                      └ <function add_lm_embeddings_to_protein at 0x7f302d43d670>
  File "/opt/apps/miniconda3/envs/model_angelo/lib/python3.9/site-packages/model_angelo-1.0.1-py3.9.egg/model_angelo/utils/protein.py", line 897, in add_lm_embeddings_to_protein
    assert len(lm_embeddings) == input_protein.unified_seq_len
               │                 │             └ 5488
               │                 └ Protein(atom_positions=None, atomc_positions=None, aatype=None, atom_mask=None, atomc_mask=None, residue_index=None, chain_in...
               └ array([[ 8.0417655e-04,  3.0484083e-01,  6.0511094e-01, ...,
                         -2.1142796e-01, -2.8297421e-01, -9.1318183e-02],
                        ...

AssertionError: assert len(lm_embeddings) == input_protein.unified_seq_len

If I (just) remove the "X" from the fasta sequence it seems to at least build a model without issue (still have to check if it is reasonable for my complete complex).

What would be the best way of dealing with these unknown residues, just delete them, replace them with glycines, or something else?
Also, it would probably be nice to catch this issue before the start of the C-alpha prediction

Activity

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment

Metadata

Metadata

Assignees

No one assigned

    Labels

    No labels
    No labels

    Type

    No type

    Projects

    No projects

      Milestone

      No milestone

      Relationships

      None yet

      Development

      No branches or pull requests

      Issue actions